DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and NPL3

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_010720.3 Gene:NPL3 / 852042 SGDID:S000002840 Length:414 Species:Saccharomyces cerevisiae


Alignment Length:115 Identity:31/115 - (26%)
Similarity:43/115 - (37%) Gaps:19/115 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 HATPKNRPRQANK--TKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTF 339
            |..|....||..:  ..::||.....|....|:...|..|||::|..:|        .||.||.|
Yeast   109 HGRPPMHHRQEGELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKIL--------NGFAFVEF 165

  Fly   340 EN-EDVVDRVCEIHFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTL 388
            |. |.....:.|:|..:..|        ||.|.|.......:.||.:..|
Yeast   166 EEAESAAKAIEEVHGKSFAN--------QPLEVVYSKLPAKRYRITMKNL 207

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity