DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and GR-RBP5

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_177563.1 Gene:GR-RBP5 / 843763 AraportID:AT1G74230 Length:289 Species:Arabidopsis thaliana


Alignment Length:78 Identity:29/78 - (37%)
Similarity:44/78 - (56%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTL 268
            |:||||:|:.|....|:|.|:.:|.|.|..|:.|..|.|||||.|:||.........:::....|
plant    35 KIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDL 99

  Fly   269 DGKKIDPKHATPK 281
            .|::|...:||.:
plant   100 HGRRIRVNYATER 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 27/73 (37%)
RRM2_MSI 292..365 CDD:240769
GR-RBP5NP_177563.1 RRM 33..111 CDD:440488 28/75 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.