DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and RBP47C

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_175180.1 Gene:RBP47C / 841157 AraportID:AT1G47490 Length:432 Species:Arabidopsis thaliana


Alignment Length:217 Identity:54/217 - (24%)
Similarity:81/217 - (37%) Gaps:69/217 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 ASAGAG----QNNGQAAMGGSNKSGSSGRSTPSLSGGSGSDPAPGKLFVGGLSWQTSSDKLKEYF 223
            ||...|    :|||                 |.||           :|||.||...|.:.|.|.|
plant   181 ASFSTGEKRLENNG-----------------PDLS-----------IFVGDLSPDVSDNLLHETF 217

  Fly   224 N-MFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKK-------IDPKHATP 280
            : .:.:|....::.|..|.||:|:||:.|.:.....|.:.    .::|.|       |.|  |||
plant   218 SEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMT----EMNGVKCSSRAMRIGP--ATP 276

  Fly   281 K-----------------NRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQT 328
            :                 .||........|||||:....:.|::|..|::||.:....:.:.   
plant   277 RKTNGYQQQGGYMPNGTLTRPEGDIMNTTIFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVG--- 338

  Fly   329 KRHRGFGFVTFENEDVVDRVCE 350
               :|.|||.|.|....:...|
plant   339 ---KGCGFVQFVNRPNAEEALE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 23/81 (28%)
RRM2_MSI 292..365 CDD:240769 17/59 (29%)
RBP47CNP_175180.1 RRM1_SECp43_like 102..184 CDD:409780 2/2 (100%)
RRM2_SECp43_like 196..275 CDD:409781 25/95 (26%)
RRM3_NGR1_NAM8_like 303..374 CDD:409782 17/61 (28%)

Return to query results.
Submit another query.