DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and AT4G26650

DIOPT Version :9

Sequence 1:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_567753.1 Gene:AT4G26650 / 828772 AraportID:AT4G26650 Length:455 Species:Arabidopsis thaliana


Alignment Length:201 Identity:82/201 - (40%)
Similarity:119/201 - (59%) Gaps:25/201 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 SGSDPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKV 260
            |.||  .||||:||:||.|..::|:|||..:|.:.:.:||:|..|.|:||||||.|.:|...|:|
plant    10 SASD--LGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERV 72

  Fly   261 LKVPIHTLDGKKIDPKHATPKN----RPRQAN----------------KTKKIFVGGVSQDTSAE 305
            : :..|.:||:.::.|.|.|::    ..|.|:                :||||||||:....:..
plant    73 I-MDKHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEA 136

  Fly   306 EVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKE 370
            |.|.||.|||.:.:.|::.|..|:|.|||||:||::|:.||.|....||.:..|.||.|:|.|||
plant   137 EFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPKE 201

  Fly   371 --AVTP 374
              :.||
plant   202 LSSTTP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 30/70 (43%)
RRM2_MSI 292..365 CDD:240769 33/72 (46%)
AT4G26650NP_567753.1 RRM1_hnRNPA_hnRNPD_like 17..87 CDD:240771 30/70 (43%)
RRM2_DAZAP1 120..199 CDD:240773 37/78 (47%)
RRM <121..280 CDD:223796 42/87 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2908
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000417
OrthoInspector 1 1.000 - - mtm1160
orthoMCL 1 0.900 - - OOG6_101082
Panther 1 1.100 - - O PTHR48032
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X310
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.