DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and SLIRP

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_112487.1 Gene:SLIRP / 81892 HGNCID:20495 Length:109 Species:Homo sapiens


Alignment Length:76 Identity:23/76 - (30%)
Similarity:41/76 - (53%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 FVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKN 358
            ||..:....::.::|.:|:|||.|...::..|::|..|||.|:|.|.:|:.:....:...|.|..
Human    22 FVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDG 86

  Fly   359 KKVECKKAQPK 369
            .||:....:||
Human    87 VKVQVHTRRPK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069
RRM2_MSI 292..365 CDD:240769 21/70 (30%)
SLIRPNP_112487.1 RRM_SLIRP 20..92 CDD:409688 21/69 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.