DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and RS2Z33

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_850280.1 Gene:RS2Z33 / 818311 AraportID:AT2G37340 Length:290 Species:Arabidopsis thaliana


Alignment Length:85 Identity:24/85 - (28%)
Similarity:39/85 - (45%) Gaps:15/85 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTL 268
            :|:||.||.:|.:..|:..|:.:|.|.||.:.:|        :.|:.|.:|...:...    |.|
plant    12 RLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD--------YAFVEFGDPRDADDAR----HYL 64

  Fly   269 DGKKIDPKHAT---PKNRPR 285
            ||:..|....|   .:..||
plant    65 DGRDFDGSRITVEFSRGAPR 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 21/73 (29%)
RRM2_MSI 292..365 CDD:240769
RS2Z33NP_850280.1 RRM_SF 12..81 CDD:473069 22/80 (28%)
PTZ00368 <86..144 CDD:173561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.