DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and hnrnpab

DIOPT Version :9

Sequence 1:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_012814656.1 Gene:hnrnpab / 734098 XenbaseID:XB-GENE-6042555 Length:326 Species:Xenopus tropicalis


Alignment Length:213 Identity:87/213 - (40%)
Similarity:121/213 - (56%) Gaps:9/213 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 ENVNASAGAGQNNGQAAMGGSNKSGSSGRSTPSLSGGSGSDPAPG-KLFVGGLSWQTSSDKLKEY 222
            |...:....|||..:.....::|........|.:|    |....| |:|||||||.||...||:|
 Frog    24 EAAESKVPGGQNGAEGDQINASKGEEDAGCVPDIS----SPLTEGVKMFVGGLSWDTSKKDLKDY 84

  Fly   223 FNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQA 287
            |:.||.|:|..|..||.|.||||||||.|::..:|:|||:...|.|||:.||||.|....:    
 Frog    85 FSKFGEVSDCTIKMDPNTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRLIDPKKAMAMKK---- 145

  Fly   288 NKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIH 352
            :..|||||||::.:...::::.||..||.:|...:.||.:|.:.|||.|:||:.|:.|.::.|..
 Frog   146 DPIKKIFVGGLNPEAGEDKIREYFETFGEIEAIELPMDPKTNKRRGFVFITFKEEEPVKKILEKK 210

  Fly   353 FHTIKNKKVECKKAQPKE 370
            ||.:...|.|.|.|||||
 Frog   211 FHNVSGSKCEIKIAQPKE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 40/70 (57%)
RRM2_MSI 292..365 CDD:240769 27/72 (38%)
hnrnpabXP_012814656.1 CBFNT 1..52 CDD:311868 5/27 (19%)
RRM1_hnRNPAB 66..140 CDD:241201 43/73 (59%)
RRM2_hnRNPAB 145..224 CDD:241028 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D496221at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.