DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and Nifk

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_080748.3 Gene:Nifk / 67949 MGIID:1915199 Length:317 Species:Mus musculus


Alignment Length:125 Identity:30/125 - (24%)
Similarity:54/125 - (43%) Gaps:17/125 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 QEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTK----KIFVGGVSQDTSAEEVKAYFS 312
            ||....||.|.    .:.|:         ..:|:|..|.|    .:::|.:....|...:..|.:
Mouse    17 QEDSQFEKALT----QIQGR---------TKKPQQKKKEKLNRGVVYLGHLPSTLSESHIYNYCA 68

  Fly   313 QFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAV 372
            |||.:....:...::|...:|:.||.||:|||...|.|...:.:..:::...|..|::.|
Mouse    69 QFGDISRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMDNYLFGERLLSCKFMPRKKV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 6/25 (24%)
RRM2_MSI 292..365 CDD:240769 17/72 (24%)
NifkNP_080748.3 RRM_NIFK_like 48..121 CDD:409748 17/72 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..317
hNIFK_binding 251..288 CDD:463489
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.