DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and cirbpb

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001035411.2 Gene:cirbpb / 678563 ZFINID:ZDB-GENE-030131-5841 Length:206 Species:Danio rerio


Alignment Length:72 Identity:31/72 - (43%)
Similarity:49/72 - (68%) Gaps:4/72 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHT 267
            ||||:||||:.|:...|:|.|:.:||:..|.:::|..|.|||||||:||:.|    :..|..:..
Zfish     5 GKLFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENP----EDAKDAMAA 65

  Fly   268 LDGKKID 274
            ::||::|
Zfish    66 MNGKQVD 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 30/71 (42%)
RRM2_MSI 292..365 CDD:240769
cirbpbNP_001035411.2 RRM_CIRBP_RBM3 5..83 CDD:409883 31/72 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.