| Sequence 1: | NP_733108.2 | Gene: | msi / 43087 | FlyBaseID: | FBgn0011666 | Length: | 634 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_080301.1 | Gene: | Zcrb1 / 67197 | MGIID: | 1914447 | Length: | 217 | Species: | Mus musculus |
| Alignment Length: | 141 | Identity: | 35/141 - (24%) |
|---|---|---|---|
| Similarity: | 57/141 - (40%) | Gaps: | 42/141 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 192 LSGGSGSDPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEP-- 254
Fly 255 ---CT--------VEKVLKVPIHTLDGKKID---------------------PKHATPKNR---- 283
Fly 284 --PRQANKTKK 292 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| msi | NP_733108.2 | RRM_SF | 204..278 | CDD:473069 | 23/107 (21%) |
| RRM2_MSI | 292..365 | CDD:240769 | 1/1 (100%) | ||
| Zcrb1 | NP_080301.1 | RRM_ZCRB1 | 9..84 | CDD:409827 | 21/74 (28%) |
| PTZ00368 | <97..123 | CDD:173561 | 2/25 (8%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 120..217 | 7/20 (35%) |