DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and TRA2B

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens


Alignment Length:73 Identity:26/73 - (35%)
Similarity:42/73 - (57%) Gaps:6/73 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 HATPKNRPR----QANKTKKIFVG--GVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFG 335
            |:....|.|    :||......:|  |:|..|:..:::..||::||:.:..::.|||::|.|||.
Human    98 HSPMSTRRRHVGNRANP
DPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFA 162

  Fly   336 FVTFENED 343
            ||.|||.|
Human   163 FVYFENVD 170

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity