DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and SRSF7

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001026854.1 Gene:SRSF7 / 6432 HGNCID:10789 Length:238 Species:Homo sapiens


Alignment Length:70 Identity:21/70 - (30%)
Similarity:34/70 - (48%) Gaps:9/70 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTL 268
            |::||.|.......:|:..|:.:|.:..|.|.::|     .||.|:.|::|...|..    :..|
Human    12 KVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNP-----PGFAFVEFEDPRDAEDA----VRGL 67

  Fly   269 DGKKI 273
            |||.|
Human    68 DGKVI 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 21/70 (30%)
RRM2_MSI 292..365 CDD:240769
SRSF7NP_001026854.1 RRM_SRSF7 12..88 CDD:410050 21/70 (30%)
Sufficient for interaction with NXF1 81..98
zf-CCHC 104..119 CDD:395050
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..238
6 X 8 AA repeats of R-R-S-R-S-X-S-X 153..226
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.