DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and SRSF6

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_006266.2 Gene:SRSF6 / 6431 HGNCID:10788 Length:344 Species:Homo sapiens


Alignment Length:168 Identity:33/168 - (19%)
Similarity:68/168 - (40%) Gaps:43/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTL 268
            ::::|.||:......::.:|:.:|.:.:|        ....|:||:.|::....:..    ::.|
Human     3 RVYIGRLSYNVREKDIQRFFSGYGRLLEV--------DLKNGYGFVEFEDSRDADDA----VYEL 55

  Fly   269 DGK-----KIDPKHATPKNRPRQANKTKKIFVGG--VSQDTSAEEVKAYFSQFGPVEETV--MLM 324
            :||     ::..:||....|.|..........||  .|:.||..:      ::||...|.  :::
Human    56 NGKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRD------KYGPPVRTEYRLIV 114

  Fly   325 DQQTKR---------HRGFGFVTF-------ENEDVVD 346
            :..:.|         .|..|.||:       .||.|::
Human   115 ENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 13/78 (17%)
RRM2_MSI 292..365 CDD:240769 16/75 (21%)
SRSF6NP_006266.2 RRM1_SRSF6 1..72 CDD:410009 15/80 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..103 7/33 (21%)
RRM2_SRSF6 110..182 CDD:410159 8/43 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..344
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.