DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and SRSF3

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_003008.1 Gene:SRSF3 / 6428 HGNCID:10785 Length:164 Species:Homo sapiens


Alignment Length:89 Identity:22/89 - (24%)
Similarity:43/89 - (48%) Gaps:6/89 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 SDPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEP-CTVEKVL 261
            |.|...|::||.|....:..:|:..|..:|.:..|.:.::|     .||.|:.|::| ...:.|.
Human     5 SCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNP-----PGFAFVEFEDPRDAADAVR 64

  Fly   262 KVPIHTLDGKKIDPKHATPKNRPR 285
            ::...||.|.::..:.:..:.|.|
Human    65 ELDGRTLCGCRVRVELSNGEKRSR 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 18/74 (24%)
RRM2_MSI 292..365 CDD:240769
SRSF3NP_003008.1 Sufficient for interaction with NXF1 and SRSP. /evidence=ECO:0000269|PubMed:12667464, ECO:0000269|PubMed:17036044, ECO:0000269|PubMed:32440474 1..90 22/89 (25%)
RRM_SRSF3 6..86 CDD:241089 19/84 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..164 2/8 (25%)
2 X approximate repeats, basic 119..164
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.