DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and hnrnpd

DIOPT Version :9

Sequence 1:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001025523.1 Gene:hnrnpd / 594903 XenbaseID:XB-GENE-988375 Length:295 Species:Xenopus tropicalis


Alignment Length:256 Identity:94/256 - (36%)
Similarity:131/256 - (51%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ALLKENVNASAGAGQNNGQAAMGGSNKSGSSGRSTPSLSGGSGSDPAPGKLFVGGLSWQTSSDKL 219
            |:::.....:...|||.|...                  ..|.::...||:|:|||||.|:...|
 Frog     8 AMMEATTAETEETGQNEGVKI------------------DASKTEEDEGKMFIGGLSWDTTKKDL 54

  Fly   220 KEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRP 284
            |:||:.||.|.|..:..||:|.|||||||:.|:|...|:||::...|.|:||.||||.|      
 Frog    55 KDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESEGVDKVMEQKEHKLNGKVIDPKRA------ 113

  Fly   285 RQANKT----KKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVV 345
             :|.||    |||||||:|.||..|:::.||..||.:|...:.||.:|.:.|||.|:||:.||.|
 Frog   114 -KAMKTKEPVKKIFVGGLSPDTPEEKIREYFGTFGEIEAIELPMDNKTNKRRGFCFITFKEEDPV 177

  Fly   346 DRVCEIHFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTLGVQLPTAPGQLIGARGAG 406
            .::.|..:|.:...|.|.|.|..||.       .|::...||.|....:.|      ||.|
 Frog   178 KKIMEKKYHNVGLSKCEIKVALSKEQ-------YQQQQQWGTRGGGSSSRP------RGRG 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 36/70 (51%)
RRM2_MSI 292..365 CDD:240769 31/72 (43%)
hnrnpdNP_001025523.1 RRM1_hnRNPD 40..113 CDD:241200 38/72 (53%)
RRM2_hnRNPD 124..198 CDD:241027 32/73 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D496221at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.