DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and RBM3

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens


Alignment Length:77 Identity:35/77 - (45%)
Similarity:53/77 - (68%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLK-VPIH 266
            ||||||||::.|....|:::|:.||.:::|:::||..||||||||||||..|......:: :...
Human     6 GKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGE 70

  Fly   267 TLDGKKIDPKHA 278
            :|||::|...||
Human    71 SLDGRQIRVDHA 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 32/74 (43%)
RRM2_MSI 292..365 CDD:240769
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 35/77 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.