DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and hnrnpd

DIOPT Version :9

Sequence 1:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001103930.1 Gene:hnrnpd / 560522 ZFINID:ZDB-GENE-070424-97 Length:314 Species:Danio rerio


Alignment Length:207 Identity:90/207 - (43%)
Similarity:121/207 - (58%) Gaps:13/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 GQNNGQAAMGGSNKSGSSGRSTPSLSGGSGSDPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDV 232
            |:..|:..|.|.|  |..|.:..|....|.::...||:|||||||.|:...||:||..||.|.|.
Zfish    21 GEGFGEEQMSGDN--GGQGEAEGSKIDASKNEEDEGKMFVGGLSWDTTKKDLKDYFTKFGEVVDC 83

  Fly   233 LIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKT----KKI 293
            .:..||:|.|||||||:.|:|..:||||:....|.|:||.||||.|       :|.||    |||
Zfish    84 TLKLDPLTGRSRGFGFVLFKEAESVEKVITQKEHKLNGKVIDPKKA-------KAMKTKEPVKKI 141

  Fly   294 FVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKN 358
            ||||:|.||..|:::.||..:|.||...:.|:.:|.:.|||.|:||:.|:.|.::.|..:|.|..
Zfish   142 FVGGLSPDTPEEKIREYFDAYGEVESIELPMENKTNKRRGFCFITFKEEEPVKKIMEKMYHNIGL 206

  Fly   359 KKVECKKAQPKE 370
            .|.|.|.|..||
Zfish   207 SKCEVKVAMSKE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 38/70 (54%)
RRM2_MSI 292..365 CDD:240769 30/72 (42%)
hnrnpdNP_001103930.1 CBFNT 3..54 CDD:285369 9/34 (26%)
RRM1_hnRNPD_like 56..129 CDD:241019 40/72 (56%)
RRM2_hnRNPD 140..214 CDD:241027 31/73 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D496221at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.