DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and msi1b

DIOPT Version :9

Sequence 1:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001013534.1 Gene:msi1b / 541389 ZFINID:ZDB-GENE-050320-86 Length:330 Species:Danio rerio


Alignment Length:323 Identity:138/323 - (42%)
Similarity:184/323 - (56%) Gaps:42/323 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 SSGRSTPSLSGGSGSDPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGF 248
            |.|..:...|..|..||.  |:|:|||||||:.:.||:||..||.|.:.::|:||||:|||||||
Zfish     3 SEGSQSNLSSSDSPHDPC--KMFIGGLSWQTTQEGLKDYFCKFGEVKESMVMRDPVTKRSRGFGF 65

  Fly   249 ITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKN-RPRQANKTKKIFVGGVSQDTSAEEVKAYFS 312
            :||.:...|:|||....|.||.|.||||.|.|:. :|:...:||||||||:|.:|:.|:||.||.
Zfish    66 VTFVDQAGVDKVLAQTRHELDSKTIDPKVAFPRRAQPKLVTRTKKIFVGGLSVNTTIEDVKQYFD 130

  Fly   313 QFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVTPA-- 375
            |||.|::.:::.|:.|.||||||||||||||||::|||||||.|.||.||||||||||.::|.  
Zfish   131 QFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGS 195

  Fly   376 ----AQLLQKRIMLGTLGVQLPTAPG-QLIGARGAGVATMNPLAMLQNPTQLL--QSPAAAAAAQ 433
                |:::...:....||:.:...|| |.....|....::.|....|.|...|  .:|.|||||.
Zfish   196 SRGRARVMPYGMDAFMLGIGMLGYPGFQATTYAGRSYTSLTPGYTYQFPAIPLTAYNPMAAAAAA 260

  Fly   434 QAALISQNPFQ-------------------------VQNAAAAASIANQAGF-----GKLLTT 466
            .|.:....|.:                         |.:..:|||.|...||     |.|:.|
Zfish   261 AAVVRGSTPSRSAGFLGTSSPGPMADLYGTANQESAVSSYLSAASPAPSTGFSHSLGGPLIAT 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 39/70 (56%)
RRM2_MSI 292..365 CDD:240769 48/72 (67%)
msi1bNP_001013534.1 RRM <16..161 CDD:223796 80/146 (55%)
RRM1_MSI1 20..96 CDD:241203 42/77 (55%)
RRM2_MSI 110..183 CDD:240769 48/72 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000417
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101082
Panther 1 1.100 - - O PTHR48032
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X310
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.