DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and Hrb98DE

DIOPT Version :9

Sequence 1:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster


Alignment Length:195 Identity:71/195 - (36%)
Similarity:116/195 - (59%) Gaps:4/195 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 NKSGSSGRSTPSLSGGSGSDPA-PGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRS 243
            |::|:|..........|.::|. ..|||:|||.::|:.:.||.:|..:|.:.||::||||.|:||
  Fly     7 NQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRS 71

  Fly   244 RGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPK---NRPRQANKTKKIFVGGVSQDTSAE 305
            |||||||:.....:::..|...|.:||:.::||.|.|:   :.|......||:|||.:..|...:
  Fly    72 RGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQ 136

  Fly   306 EVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKE 370
            .::.||..||.:.:..:::|::|.:.|||.||.|::.|.||:|.....|.:..|.|:.|||.||:
  Fly   137 SIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 201

  Fly   371  370
              Fly   202  201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 30/70 (43%)
RRM2_MSI 292..365 CDD:240769 24/72 (33%)
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 34/76 (45%)
RRM_SF 123..195 CDD:302621 24/71 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.