DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment msi and SLIRP2

DIOPT Version :9

Sequence 1:	NP_001247303.1	Gene:	msi / 43087	FlyBaseID:	FBgn0011666	Length:	634	Species:	Drosophila melanogaster
Sequence 2:	NP_649808.1	Gene:	SLIRP2 / 41021	FlyBaseID:	FBgn0037602	Length:	91	Species:	Drosophila melanogaster

Alignment Length:	75	Identity:	23/75 - (30%)
Similarity:	37/75 - (49%)	Gaps:	0/75 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTL 268
            |||||.|.|...|.:|:.||:.:|.|.:..::.|.....|:.:||:.|.:............|.|
  Fly    11 KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQNTHFL 75

  Fly   269 DGKKIDPKHA 278
            ||:.:..:.|
  Fly    76 DGRVLTVQRA 85

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
msi	NP_001247303.1	RRM1_hnRNPA_hnRNPD_like	205..276	CDD:240771	21/70 (30%)
msi	NP_001247303.1	RRM2_MSI	292..365	CDD:240769
SLIRP2	NP_649808.1	RRM_SLIRP	11..83	CDD:240688	22/71 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45463983
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.840