DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and srsf7a

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_991236.1 Gene:srsf7a / 402972 ZFINID:ZDB-GENE-040426-1798 Length:258 Species:Danio rerio


Alignment Length:81 Identity:21/81 - (25%)
Similarity:39/81 - (48%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 SLSGGSGSDPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPC 255
            |.|..|.|..:..|::||.|....:..:|:..|:.:|.:..|.:.::|     .||.|:.:::..
Zfish     2 SYSSRSSSRTSDCKVYVGDLGNGAAKGELERAFSYYGPLRSVWVARNP-----PGFAFVEYEDAR 61

  Fly   256 TVEKVLKVPIHTLDGK 271
            ..|..:|    .:|||
Zfish    62 DAEDAVK----GMDGK 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 17/68 (25%)
RRM2_MSI 292..365 CDD:240769
srsf7aNP_991236.1 RRM_SF 15..91 CDD:473069 17/68 (25%)
zf-CCHC 106..121 CDD:395050
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.