DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and CG3335

DIOPT Version :9

Sequence 1:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:262 Identity:63/262 - (24%)
Similarity:105/262 - (40%) Gaps:58/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PKQEPAQQAALALLKENVNASAGAGQNNGQAAMGGSNKSGSSGRSTPSLSGGSGSDPAPGKLFVG 208
            ||.||..       ||.|........|:.:.....|....:.....|:.:           ||:.
  Fly   638 PKSEPKP-------KEEVKPEEKPIVNDAKPDEEDSRAEDADDEPEPNTT-----------LFLR 684

  Fly   209 GLSWQTSSDKLKEYFNMFGTVTDVLIMK--DPVTQR---SRGFGFITFQEPCTVEKVLK-VPIHT 267
            .|:::|..:.::::|...|::..|.|.|  ||...|   |.|:|||.|::....|..|| :.:..
  Fly   685 NLNFKTVQETVEKHFRHLGSIHTVEIAKRRDPENPREFKSLGYGFIQFKKSSVAEHALKNLQLTH 749

  Fly   268 LDGKKIDPKHA-----TPKN---RPRQANKTK----KIFVGGVSQDTSAEEVKAYFSQFGPVEET 320
            :||..::.|.:     |..|   :.|.|::.|    ||.|..:.......||:..|..||.:...
  Fly   750 IDGNPVELKRSDRVLKTQDNDGAQRRLASQKKQTGTKILVRNIPFQAQYREVRDIFKAFGELRSL 814

  Fly   321 VMLMDQQT--KRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVTPAAQLLQKRI 383
            .:.....|  ..|||||||.:.:                  |.|.|:|  .:|::.:..|..:|:
  Fly   815 RIPKKATTGEDAHRGFGFVDYMS------------------KAEAKRA--FDALSASTHLYGRRL 859

  Fly   384 ML 385
            :|
  Fly   860 VL 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 23/76 (30%)
RRM2_MSI 292..365 CDD:240769 18/74 (24%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 59/244 (24%)
RRM5_RBM19_like 679..760 CDD:240764 24/91 (26%)
RRM6_RBM19 785..864 CDD:241015 24/97 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463990
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.