DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and TBPH

DIOPT Version :9

Sequence 1:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:498 Identity:107/498 - (21%)
Similarity:176/498 - (35%) Gaps:108/498 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 EQPKQEPAQQ---AALALLKENVNASAGAGQNNGQAAMGGSNKSGSSGRSTPSLSGGSGS----- 198
            ::|.:.||::   ..|:.|:.....|.|....|.........:|.......||:..|.|.     
  Fly    12 DEPIELPAEEDGTLLLSTLQAQFPGSCGLKYRNLDTKAVRGVRSNEGRLFPPSVESGWGEYAYFC 76

  Fly   199 -DPAPGK-------------------------LFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKD 237
             .|...|                         |.|.||.|:|:.:.|:|||..:|.|....|.||
  Fly    77 VFPKENKRKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKD 141

  Fly   238 PVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTKKIFVGGVSQDT 302
            ..:.:|:||||:.|.......:|| ...|.:||:..:.|....|....|.  ..|:|||..::|.
  Fly   142 TKSGQSKGFGFVRFGSYDAQMRVL-TNRHLIDGRWCEVKVPNSKGMGHQV--PCKVFVGRCTEDI 203

  Fly   303 SAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQ 367
            ::::::.|||:||.|.:..:     .:..|.|.||||.:.||...:|. ..|.||...|....|.
  Fly   204 NSDDLREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLCG-EDHIIKGVSVHVSNAA 262

  Fly   368 PKEAVTPAAQLLQKRIMLGTLGVQLPTAPGQLIGARGAGVATMNPLAMLQNPTQLLQSPAAAAAA 432
            ||     |.|...:::......           .|...|:.:.:|.....||         ....
  Fly   263 PK-----AEQNRNQQVQSYNYN-----------SANSFGMHSYHPQGNHMNP---------GRNG 302

  Fly   433 QQAALISQNPFQVQNAAAAASIANQAGFGKLLTTYPQTALHSVRYAPYSIPASAATANAALMQAH 497
            ........|....:||.    :.|.               |::..|.|.:..:....|:.....:
  Fly   303 HHRGNNQHNAHGGENAI----VPNN---------------HNIGTAGYGMGGNNYGGNSGGGYHN 348

  Fly   498 QAQSVAAAAHHHQQ-------QQQQQHHHQQQTHNAHVAAAQQQQQSHHNAVSNPASQAHSAAAA 555
            ...:.::..:.::|       .:|...|...|.||.:|..:.......|..:.|           
  Fly   349 NGGNHSSGGNTNRQDGGSQYNSRQSNFHGMNQPHNGNVGGSNGWMNRGHLDMPN----------- 402

  Fly   556 AALAANAANGAGAAGAHSLAAAAQQAGLMAGN-PLNAAAAAAA 597
              |.|...|..|::.::.....:.|:.|...: |:|.|..|||
  Fly   403 --LQALGINSQGSSSSNQGQNMSNQSMLNLNSLPINPALVAAA 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 26/70 (37%)
RRM2_MSI 292..365 CDD:240769 24/72 (33%)
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 27/76 (36%)
RRM2_TDP43 192..261 CDD:240768 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.