DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment msi and SLIRP1

DIOPT Version :9

Sequence 1:	NP_001247303.1	Gene:	msi / 43087	FlyBaseID:	FBgn0011666	Length:	634	Species:	Drosophila melanogaster
Sequence 2:	NP_001027083.1	Gene:	SLIRP1 / 3772560	FlyBaseID:	FBgn0064117	Length:	90	Species:	Drosophila melanogaster

Alignment Length:	71	Identity:	23/71 - (32%)
Similarity:	38/71 - (53%)	Gaps:	0/71 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTL 268
            ::|||.|.|.....:|:.||..||.|....::.|..|..|:|:||::|.....:||:.....|.|
  Fly    16 RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHIL 80

  Fly   269 DGKKID 274
            :|..::
  Fly    81 EGNYLN 86

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
msi	NP_001247303.1	RRM1_hnRNPA_hnRNPD_like	205..276	CDD:240771	23/70 (33%)
msi	NP_001247303.1	RRM2_MSI	292..365	CDD:240769
SLIRP1	NP_001027083.1	RRM_SLIRP	16..88	CDD:409688	23/71 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45463984
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.840