DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and hnrnpa0a

DIOPT Version :9

Sequence 1:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_997810.2 Gene:hnrnpa0a / 323529 ZFINID:ZDB-GENE-030131-2249 Length:305 Species:Danio rerio


Alignment Length:206 Identity:72/206 - (34%)
Similarity:109/206 - (52%) Gaps:28/206 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTL 268
            |||||||:.||:.|.|:.:|..:|.:||.:::::...:|||.|||:|:..|...:..:....|.|
Zfish    11 KLFVGGLNVQTTDDGLRNHFEQYGKLTDCVVVQNQQLKRSRCFGFVTYSSPDEADSAMSARPHIL 75

  Fly   269 DGKKIDPKHATPK---NRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKR 330
            ||..::.|.|..:   .:|....|.||||:||:..|...:.::..|||||.||:..::.|::|.:
Zfish    76 DGNNVELKRAVAREDAGKPEALAKVKKIFIGGLKDDIEEDHLRDCFSQFGAVEKAEVITDKETGK 140

  Fly   331 HRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTLGVQLPTA 395
            .||||||.||:.|..|:...:.||.|...|||.|||..|:.:                       
Zfish   141 KRGFGFVYFEDNDSADKAVVLKFHIINGHKVEVKKALTKQEM----------------------- 182

  Fly   396 PGQLIGARGAG 406
              |..|:||.|
Zfish   183 --QAAGSRGGG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 26/70 (37%)
RRM2_MSI 292..365 CDD:240769 31/72 (43%)
hnrnpa0aNP_997810.2 RRM1_hnRNPA0 8..86 CDD:240772 28/74 (38%)
RRM_SF 102..181 CDD:302621 35/78 (45%)
HnRNPA1 260..286 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.