Sequence 1: | NP_001247303.1 | Gene: | msi / 43087 | FlyBaseID: | FBgn0011666 | Length: | 634 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997810.2 | Gene: | hnrnpa0a / 323529 | ZFINID: | ZDB-GENE-030131-2249 | Length: | 305 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 72/206 - (34%) |
---|---|---|---|
Similarity: | 109/206 - (52%) | Gaps: | 28/206 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 204 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTL 268
Fly 269 DGKKIDPKHATPK---NRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKR 330
Fly 331 HRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTLGVQLPTA 395
Fly 396 PGQLIGARGAG 406 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
msi | NP_001247303.1 | RRM1_hnRNPA_hnRNPD_like | 205..276 | CDD:240771 | 26/70 (37%) |
RRM2_MSI | 292..365 | CDD:240769 | 31/72 (43%) | ||
hnrnpa0a | NP_997810.2 | RRM1_hnRNPA0 | 8..86 | CDD:240772 | 28/74 (38%) |
RRM_SF | 102..181 | CDD:302621 | 35/78 (45%) | ||
HnRNPA1 | 260..286 | CDD:288479 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |