DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and HNRNPAB

DIOPT Version :9

Sequence 1:NP_001247303.1 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens


Alignment Length:253 Identity:97/253 - (38%)
Similarity:132/253 - (52%) Gaps:46/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 GLEQPKQEPAQQAALALLKENVNASAGAGQNNGQAAMGGSNKSGSSGRSTPSLSGGSGSDPAP-- 202
            |.|||.:                 :.||.:|..:|...|.:.:|:   .|.:.:|..|:..||  
Human     5 GEEQPME-----------------TTGATENGHEAVPEGESPAGA---GTGAAAGAGGATAAPPS 49

  Fly   203 --------------------GKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFG 247
                                ||:|||||||.||...||:||..||.|.|..|..||.|.||||||
Human    50 GNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFG 114

  Fly   248 FITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTKKIFVGGVSQDTSAEEVKAYFS 312
            ||.|::..:|||||....|.|||:.||||.|....:    :..|||||||::.:.:.|:::.||.
Human   115 FILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKK----DPVKKIFVGGLNPEATEEKIREYFG 175

  Fly   313 QFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKE 370
            :||.:|...:.||.:..:.|||.|:||:.|:.|.:|.|..|||:...|.|.|.|||||
Human   176 EFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_001247303.1 RRM1_hnRNPA_hnRNPD_like 205..276 CDD:240771 41/70 (59%)
RRM2_MSI 292..365 CDD:240769 29/72 (40%)
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868 15/84 (18%)
RRM1_hnRNPAB 66..145 CDD:410151 45/78 (58%)
RRM2_hnRNPAB 150..229 CDD:409997 31/82 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D496221at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.