Sequence 1: | NP_001247303.1 | Gene: | msi / 43087 | FlyBaseID: | FBgn0011666 | Length: | 634 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001317178.1 | Gene: | HNRNPA3 / 220988 | HGNCID: | 24941 | Length: | 378 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 77/203 - (37%) |
---|---|---|---|
Similarity: | 118/203 - (58%) | Gaps: | 13/203 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 186 GRSTPSLS------GGSGSDPAP----GKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVT 240
Fly 241 QRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKN---RPRQANKTKKIFVGGVSQDT 302
Fly 303 SAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQ 367
Fly 368 PKEAVTPA 375 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
msi | NP_001247303.1 | RRM1_hnRNPA_hnRNPD_like | 205..276 | CDD:240771 | 31/70 (44%) |
RRM2_MSI | 292..365 | CDD:240769 | 28/72 (39%) | ||
HNRNPA3 | NP_001317178.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..35 | 7/26 (27%) | |
RRM1_hnRNPA_like | 36..113 | CDD:409992 | 35/76 (46%) | ||
RRM2_hnRNPA3 | 126..205 | CDD:409996 | 32/78 (41%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..225 | 2/7 (29%) | |||
HnRNPA1 | 331..>347 | CDD:402981 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 336..378 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |