DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and Tia1

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_035715.1 Gene:Tia1 / 21841 MGIID:107914 Length:386 Species:Mus musculus


Alignment Length:125 Identity:22/125 - (17%)
Similarity:38/125 - (30%) Gaps:46/125 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRGKGGKGLGK---GGAKRHRKVLR-------------------DNIQGITKP-----------A 34
            |.|.||:||.:   ....|.||...                   .|...:.||           |
Mouse   535 GSGGGGEGLMQEMNALLARRRKASEKPEDSQNEESNGSPSSSRGQNSDPVKKPWERANSADKSSA 599

  Fly    35 IRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQ 94
            :.|....|.........::..:   :..||.|:|:.....|          :::.|::|:
Mouse   600 VSRAKPLGSTSDAESFDFDRMK---QEILEEVVRELQKVKE----------EIIDAIRRE 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069
RRM2_MSI 292..365 CDD:240769
Tia1NP_035715.1 RRM1_TIA1 8..81 CDD:410027
RRM2_TIA1 104..181 CDD:410030
RRM3_TIAR 214..286 CDD:241064
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..376
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.