DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and Rbm3

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_058089.2 Gene:Rbm3 / 19652 MGIID:1099460 Length:154 Species:Mus musculus


Alignment Length:77 Identity:35/77 - (45%)
Similarity:53/77 - (68%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLK-VPIH 266
            ||||||||::.|....|:::|:.||.:::|:::||..||||||||||||..|......:: :...
Mouse     6 GKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAMNGE 70

  Fly   267 TLDGKKIDPKHA 278
            :|||::|...||
Mouse    71 SLDGRQIRVDHA 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 32/74 (43%)
RRM2_MSI 292..365 CDD:240769
Rbm3NP_058089.2 RRM_CIRBP_RBM3 6..85 CDD:409883 35/77 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.