DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and rnp-7

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_498565.2 Gene:rnp-7 / 176002 WormBaseID:WBGene00004390 Length:332 Species:Caenorhabditis elegans


Alignment Length:141 Identity:37/141 - (26%)
Similarity:62/141 - (43%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PSLSGGSGSDPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEP 254
            |:.:..:..||. ..||||.::::||..||:..|..:|.:..:.::.|. ..:.||:.||.:.: 
 Worm    92 PAENPRASEDPY-RTLFVGRINYETSESKLRREFEAYGKIKKLTMVHDE-AGKPRGYAFIEYSD- 153

  Fly   255 CTVEKVLKVPIHT----LDGKKIDPKHATPKNRPRQANKTKKIF----VGGVSQDT-------SA 304
                   |..:||    .||.|:|.|....   ..:..:|:|.:    :||...||       |.
 Worm   154 -------KAEMHTAYKKADGIKVDGKRLVV---DYERGRTQKTWLPRRLGGGKGDTRKTREAKSV 208

  Fly   305 EEVKAYFSQFG 315
            .|.:...|.||
 Worm   209 IEEREIASGFG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 23/77 (30%)
RRM2_MSI 292..365 CDD:240769 10/35 (29%)
rnp-7NP_498565.2 U1snRNP70_N 4..95 CDD:432406 1/2 (50%)
RRM_snRNP70 103..192 CDD:409682 25/101 (25%)

Return to query results.
Submit another query.