DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msi and CIRBP

DIOPT Version :10

Sequence 1:NP_733108.2 Gene:msi / 43087 FlyBaseID:FBgn0011666 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens


Alignment Length:95 Identity:33/95 - (34%)
Similarity:59/95 - (62%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHT 267
            |||||||||:.|:...|::.|:.:|.:::|:::||..|||||||||:||:   .::.. |..:..
Human     6 GKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFE---NIDDA-KDAMMA 66

  Fly   268 LDGKKIDPKHATPKNRPRQANKTKKIFVGG 297
            ::||.:|.:........:.::...:.:.||
Human    67 MNGKSVDGRQIRVDQAGKSSDNRSRGYRGG 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
msiNP_733108.2 RRM_SF 204..278 CDD:473069 30/73 (41%)
RRM2_MSI 292..365 CDD:240769 2/6 (33%)
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 31/82 (38%)

Return to query results.
Submit another query.