DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and LIPG

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_005258447.1 Gene:LIPG / 9388 HGNCID:6623 Length:536 Species:Homo sapiens


Alignment Length:356 Identity:98/356 - (27%)
Similarity:159/356 - (44%) Gaps:50/356 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LHTLVPQDNANRQTGP-LKSEKESPHRRLFQQVVGNTLTAAFGLNVMNKGDQEQNQQFTSEPVNL 148
            |.:.:|.:.|..:.|| ::..::..|:   .:.....:..:...|:....|.|....:.|    :
Human    47 LESQLPAERAREEAGPSVRRPRDKLHK---PKATQTEVKPSVRFNLRTSKDPEHEGCYLS----V 104

  Fly   149 YDAASLRRSRFSPFNPTRILIHGW-LGNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYI 212
            ..:..|....|:....|..:|||| :.....|..::|:.| ...|..:.|:..|||...|...|.
Human   105 GHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSA-LHTREKDANVVVVDWLPLAHQLYT 168

  Fly   213 TASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPAL 277
            .|....:.||..:|:.:|:|.::......::.|:|:|:||||||.||..:: |.:..|..||||.
Human   169 DAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVK-GTVGRITGLDPAG 232

  Fly   278 PFFRYAKPKERLTAEDADYVEVLHTSVGSY----GFDRPVGHVDFYANWGSQQPGCFWHE----- 333
            |.|..|...:||:.:|||:|:||||...|:    |...||||:|.|.|.|..||||..::     
Human   233 PMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQPGCGLNDVLGSI 297

  Fly   334 ----------CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQ----LTRFHRCPKDTGVMQTM 384
                      |.|.||..||.:||.......|..|...:..:::    ..|.:||       .::
Human   298 AYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDSNRFKKGICLSCRKNRC-------NSI 355

  Fly   385 GGDLANV-----SAEFLAQRQG----VYYFQ 406
            |.:...:     |..:|..|.|    ||::|
Human   356 GYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 89/302 (29%)
LIPGXP_005258447.1 Pancreat_lipase_like 85..376 CDD:238363 87/303 (29%)
lipo_lipase 86..521 CDD:132274 92/314 (29%)
PLAT_LPL 383..519 CDD:238856 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145242
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.