DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and Pla1a

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_620237.1 Gene:Pla1a / 85311 RGDID:621261 Length:456 Species:Rattus norvegicus


Alignment Length:300 Identity:94/300 - (31%)
Similarity:140/300 - (46%) Gaps:47/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 ASLRRSRFSPFNPTRILIHGW--LGNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITA 214
            :.:|.|.|:....|:::|||:  ||.: .:..|:.:.|.  ||..:.|:..|||..|:...|.:|
  Rat    71 SDIRNSEFNASLGTKLIIHGFRALGTK-PSWINKFIRAL--LRAADANVIAVDWVYGSTGMYFSA 132

  Fly   215 SYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPF 279
            ...|..:...:::|:..| .|.|:....:.::|.|:||||.|:.| |...|:|..|..||||.|.
  Rat   133 VENVVKLSLEISRFLSKL-LELGVSESSIHIIGVSLGAHVGGMVG-HFYKGQLGRITGLDPAGPE 195

  Fly   280 FRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQPGC--FWHE------CSH 336
            :..|..:|||.:.||.:||.:||...:.|...||||||::.|.|..||||  |.|.      |.|
  Rat   196 YTRASLEERLDSGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPAFIHAGYSYLICDH 260

  Fly   337 WRAFMLFAESLARD---------QATGFLSQGCPAAEWQQLTRFH----RCPKDTGVMQTMGGDL 388
            .||..|:..:|...         ....||:..|       |..|:    .||: .|:::..|   
  Rat   261 MRAVHLYISALENTCPLMAFPCASYKAFLAGDC-------LDCFNPFLLSCPR-IGLVERGG--- 314

  Fly   389 ANVSAEFLAQRQGVYYFQTNDQPPY-----VLAQNASSKR 423
              |..|.|.:...| |.||....||     ::..|...||
  Rat   315 --VKIEPLPKEVRV-YLQTTSSAPYCVHHSLVEFNLKEKR 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 89/279 (32%)
Pla1aNP_620237.1 Lipase 14..336 CDD:278576 89/283 (31%)
Pancreat_lipase_like 49..332 CDD:238363 89/279 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.