DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:338 Identity:91/338 - (26%)
Similarity:141/338 - (41%) Gaps:54/338 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 TAAFGLNVMNKGDQEQNQQF---TSE------PVNLYDAASLRRSRFSPFNPTRILIHGWLGNEN 177
            ||...|.::....::.|.:|   |:|      .:.|.|..::..|.|.....||.:|||::....
  Rat    37 TAIRPLKLLPWSPEKINTRFLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKGE 101

  Fly   178 ANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFED 242
            .|...::....|.:.  ..|...|||.:|:...|..|:..|:.||..:|:.:|.|.:........
  Rat   102 ENWVVDMCKNMFQVE--EVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQMIDILVKNYSYSPSK 164

  Fly   243 LQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVG-- 305
            :.|:|.|:||||||.||.  :|..|..|..|||....|.....:.||...|||:|:|:||...  
  Rat   165 VHLIGHSLGAHVAGEAGS--RTPGLGRITGLDPVEANFEGTPEEVRLDPSDADFVDVIHTDAAPL 227

  Fly   306 ----SYGFDRPVGHVDFYANWGSQQPGC-------------FWH------ECSHWRAFMLFAESL 347
                .:|.::..||:||:.|.|...|||             .|.      .|:|.|::..:.||:
  Rat   228 IPFLGFGTNQMSGHLDFFPNGGQSMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESI 292

  Fly   348 ARDQATGFLSQGCPAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPP 412
            ....  ||.:..|.:.:..:..:...|| |.|..| ||.     .|:..|.:.|       |:|.
  Rat   293 LNPD--GFAAYPCASYKDFESNKCFPCP-DQGCPQ-MGH-----YADKFAGKSG-------DEPQ 341

  Fly   413 YVLAQNASSKRAA 425
            ........:|..|
  Rat   342 KFFLNTGEAKNFA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 84/304 (28%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 90/335 (27%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.