DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and Pnlip

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_081201.2 Gene:Pnlip / 69060 MGIID:97722 Length:465 Species:Mus musculus


Alignment Length:326 Identity:93/326 - (28%)
Similarity:144/326 - (44%) Gaps:50/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 FTSEPVNLY-----DAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFT 200
            :|:|..:.|     ||:::|.|.|.....|||:|||::.....|..:::....|  |..:.|...
Mouse    58 YTNENPDNYQLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEENWLSDMCKNMF--RVESVNCIC 120

  Fly   201 VDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTG 265
            |||..|:...|..|:..|:.||..:|..|:.|..:.|....::.|:|.|:|:|:||.|||. ..|
Mouse   121 VDWKGGSRTTYTQATQNVRVVGAEVALLVNVLQSDLGYSLNNVHLIGHSLGSHIAGEAGKR-TFG 184

  Fly   266 RLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVG------SYGFDRPVGHVDFYANWGS 324
            .:..|..||||.|:|:....:.||...||.:|:.:||..|      .:|..:.|||:||:.|.|.
Mouse   185 AIGRITGLDPAEPYFQGTPEEVRLDPTDAQFVDAIHTDAGPIIPNLGFGMSQTVGHLDFFPNGGI 249

  Fly   325 QQPGC-------------FWH------ECSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTR 370
            :.|||             .|.      .|:|.|::..:.:|:.  ..|||....|.:   ..|..
Mouse   250 EMPGCQKNILSQIVDIDGIWEGTRNFAACNHLRSYKFYTDSIV--NPTGFAGFSCSS---YSLFT 309

  Fly   371 FHRC-PKDTGVMQTMG--GDLANVSAEFLAQRQGVYYFQTNDQPPY------VLAQNASSKRAAH 426
            .::| |..:|....||  .|........|.|   .:|..|.|:..:      |....:..|...|
Mouse   310 ANKCFPCGSGGCPQMGHYADRYPGKTSRLYQ---TFYLNTGDKSNFARWRYQVTVTLSGQKVTGH 371

  Fly   427 I 427
            |
Mouse   372 I 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 88/300 (29%)
PnlipNP_081201.2 Lipase 18..352 CDD:278576 89/304 (29%)
Pancreat_lipase_like 51..348 CDD:238363 88/300 (29%)
PLAT_PL 355..465 CDD:238857 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835387
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.