DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and Liph

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_038944552.1 Gene:Liph / 681694 RGDID:1592849 Length:476 Species:Rattus norvegicus


Alignment Length:369 Identity:95/369 - (25%)
Similarity:155/369 - (42%) Gaps:93/369 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 VVGNTLTAAFGLNVMNKGDQEQNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANM 180
            |||..|:....|       ..|..|..::.:|.....||..::     .|..:|||:....:..:
  Rat    71 VVGTGLSVRLML-------YTQRDQTCAQVINSTALGSLNVTK-----KTTFIIHGFRPTGSPPV 123

  Fly   181 Y-NELLPAYFDLRNGNYNIFTVDWGRGA-IADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDL 243
            : .||:.:...::  ..|:..|||.||| ...|..||.:.:.|..:|.:|:|.:..: |...:::
  Rat   124 WMEELVQSLISVQ--EMNVVVVDWNRGATTVIYPHASSKTRKVALILKEFIDQMLAK-GASLDNI 185

  Fly   244 QLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYG 308
            .::|.|:|||:||..|: :.:|:|..|..||||.|.|....|::||...||.:|:|:|:...:.|
  Rat   186 YMIGVSLGAHIAGFVGE-MYSGKLGRITGLDPAGPLFNGRPPEDRLDPSDAQFVDVIHSDTDALG 249

  Fly   309 FDRPVGHVDFYANWGSQQPGC--------FWHECSHWRAFMLFAESLA-------------RDQA 352
            :...:||:|||.|.|..||||        .:.:|.|..:..|:..||.             ||..
  Rat   250 YREALGHIDFYPNGGLDQPGCPKTIFGGIKYFKCDHQMSVFLYLASLQNNCSITAYPCDSYRDYR 314

  Fly   353 TG-FLSQG------CP-----AAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYF 405
            .| .:|.|      ||     |..|::.. :.|.|..|..                       :|
  Rat   315 NGKCVSCGAGHIVSCPSLGYYADNWREYL-WDRDPPMTKA-----------------------FF 355

  Fly   406 QTNDQPPY--------VLAQNASSKRA----------AHIQENK 431
            .|.:..||        :::.|.|.:|.          .:|.|:|
  Rat   356 DTAETKPYCIYHYFVDIISWNKSVRRGFITIKLRGEDGNITESK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 81/305 (27%)
LiphXP_038944552.1 Pancreat_lipase_like 78..347 CDD:238363 78/285 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.