DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG34447

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:283 Identity:93/283 - (32%)
Similarity:140/283 - (49%) Gaps:23/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 TSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTVDWG-R 205
            |.|...|.|...|....|.|..|.:|||||:.|:.:....:.:.|...|  :.:..:.::|:| .
  Fly    51 TRENPILLDPLDLNPWNFQPPRPLKILIHGYTGDRDFAPNSYIRPVLLD--HEDVYVISIDYGPL 113

  Fly   206 GAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMI 270
            .....||.|...:..|.:.||:.::.|...|.:..:.:.|:|||:|..|||....:::. :::.|
  Fly   114 VRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQTANYVKR-KMKRI 177

  Fly   271 RALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQPGCFWH--- 332
            ..||||.|.|.......||...|||:|:|:||.|...|:.|..||||||.|:|::||||...   
  Fly   178 TGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGRGYLRAAGHVDFYPNFGAKQPGCMEENMQ 242

  Fly   333 ---ECSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAE 394
               .|:|.||...:|||:  :...||.::.|.....|.||   .|| .||....:|   .:||.|
  Fly   243 DPSSCNHERAPRFYAESI--NTTVGFWARQCSGWLLQLLT---LCP-TTGAQALLG---YHVSDE 298

  Fly   395 FLAQRQGVYYFQTNDQPPYVLAQ 417
            .    :|.|:.||..:.||.|.:
  Fly   299 L----RGSYFLQTASKSPYALGK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 90/273 (33%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 90/273 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.