DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG34448

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster


Alignment Length:284 Identity:85/284 - (29%)
Similarity:135/284 - (47%) Gaps:25/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 QFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTVDWG 204
            |...:|:.| |..:.::..|.|..|.:|||||::||.|.....|:....  |:....|:.:||:|
  Fly    52 QTRDDPIQL-DPLNPQKDVFQPRLPLKILIHGFIGNRNLTPNLEVRDVL--LQTQPINVISVDYG 113

  Fly   205 RGA--IADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRL 267
            ...  ...|..|......|.:.||:.::.|......|.||:.|:|||:||.|||:...:: :..|
  Fly   114 TLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVAGMVANYV-SQPL 177

  Fly   268 RMIRALDPALP-FFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGS-QQPGCF 330
            ..|..||||.| |......:::|.|.|||:|:::||....:....|:||.|||.|... .|.||.
  Fly   178 ARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGCS 242

  Fly   331 W------HECSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRCPKDTGVMQTMGGDLA 389
            :      :.|:|:||.:.:.||:..::  ||.:|.|  ..|..... .||...:.:..|..|...
  Fly   243 YISNWRFYNCNHYRAAVYYGESIISER--GFWAQQC--GGWFDFFS-QRCSHYSNMPNTQMGYFV 302

  Fly   390 NVSAEFLAQRQGVYYFQTNDQPPY 413
            :..|      .|.|:..|::..|:
  Fly   303 SEDA------SGSYFLTTHEVAPF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 84/278 (30%)
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 84/278 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445935
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.