DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and PLA1A

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_056984.1 Gene:PLA1A / 51365 HGNCID:17661 Length:456 Species:Homo sapiens


Alignment Length:345 Identity:103/345 - (29%)
Similarity:151/345 - (43%) Gaps:88/345 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LNVMNKGD-----QEQNQQFTSEPVNLYDAASLRRS--RFSPFNP-------------------- 164
            |:|.:.||     |.:...|.|  .||::...|:..  .|.|.||                    
Human    19 LSVGSSGDAPPTPQPKCADFQS--ANLFEGTDLKVQFLLFVPSNPSCGQLVEGSSDLQNSGFNAT 81

  Fly   165 --TRILIHGW--LGNENANMYNELLPAYFD------LRNGNYNIFTVDWGRGAIADYITASYRVK 219
              |:::|||:  ||.:         |::.|      ||..|.|:..|||..|:...|.:|   ||
Human    82 LGTKLIIHGFRVLGTK---------PSWIDTFIRTLLRATNANVIAVDWIYGSTGVYFSA---VK 134

  Fly   220 PVGQVLAKFVDFLHQ--EAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRY 282
            .|.::..:...||::  ..|:....:.::|.|:||||.|:.|: |..|:|..|..||||.|.:..
Human   135 NVIKLSLEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVGQ-LFGGQLGQITGLDPAGPEYTR 198

  Fly   283 AKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQPGC--FWHE------CSHWRA 339
            |..:|||.|.||.:||.:||...:.|...||||||::.|.|..||||  |::.      |.|.||
Human   199 ASVEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRA 263

  Fly   340 FMLFAESLARD---------QATGFLSQGCPAAEWQQLTRFH----RCPKDTGVMQTMGGDLANV 391
            ..|:..:|...         ....||:..|       |..|:    .||: .|::: .||    |
Human   264 VHLYISALENSCPLMAFPCASYKAFLAGRC-------LDCFNPFLLSCPR-IGLVE-QGG----V 315

  Fly   392 SAEFLAQRQGVYYFQTNDQP 411
            ..|.|.:...||...|:..|
Human   316 KIEPLPKEVKVYLLTTSSAP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 97/325 (30%)
PLA1ANP_056984.1 Lipase 16..336 CDD:278576 103/345 (30%)
Pancreat_lipase_like 49..332 CDD:238363 92/308 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145183
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.