DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and liph

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001011098.1 Gene:liph / 496511 XenbaseID:XB-GENE-5847665 Length:460 Species:Xenopus tropicalis


Alignment Length:332 Identity:92/332 - (27%)
Similarity:144/332 - (43%) Gaps:71/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LNVMNK----GDQEQNQQFTSE-PVNLYDAASLRRSRFSPFNPTR---ILIHGWLGNENANMY-N 182
            ||:.|.    |.:.|...:|.| |....|......:.|...|.||   .:.||:....:..:: :
 Frog    34 LNIHNSIIGTGLKVQLLLYTRENPKCAQDLNVDNSTGFQYLNVTRRTVFITHGYRPTGSPPVWID 98

  Fly   183 ELLPAYFDLRNGNYNIFTVDWGRGAIAD-YITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLV 246
            :::..:.|::  ::|:..|||.|||... |..|:...:.|..:|.:|:|.:..: |...:.:.:|
 Frog    99 DIVKKFLDIQ--DFNVIVVDWNRGATTVLYHNAAANTRKVADILKRFIDNMLSQ-GATLDSIYMV 160

  Fly   247 GFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFDR 311
            |.|:|||::|..|| :..|.:..|..||||.|.|....|:|||...||.:|:|:|:.....|:..
 Frog   161 GVSLGAHISGFVGK-MYNGSIGRITGLDPAGPLFNGKPPEERLHYTDAQFVDVVHSDTDGLGYKE 224

  Fly   312 PVGHVDFYANWGSQQPGC--------FWHECSHWRAFMLFAESLA-------------RDQATG- 354
            .:||:|||.|.|:.||||        .:.:|.|.|:..|:..||.             ||...| 
 Frog   225 SLGHIDFYPNGGTDQPGCPKTILAGSEYFKCDHQRSVFLYIASLTKSCDLVAFPCKSYRDYRIGN 289

  Fly   355 ------FLSQGCP-----AAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTN 408
                  ||...||     |.:|          ||..|.:...|..|              :|.|.
 Frog   290 CTDCKEFLPLSCPVLGFYADKW----------KDHLVKRNHPGTTA--------------FFDTA 330

  Fly   409 DQPPYVL 415
            .:.||.:
 Frog   331 AKDPYCI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 85/309 (28%)
liphNP_001011098.1 Pancreat_lipase_like 45..312 CDD:238363 79/280 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.