DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and lipia

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001003499.1 Gene:lipia / 445105 ZFINID:ZDB-GENE-040801-242 Length:454 Species:Danio rerio


Alignment Length:278 Identity:83/278 - (29%)
Similarity:129/278 - (46%) Gaps:37/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASY--RVK 219
            |:|:..:.|..||||:....:..::.:.. ..|.|...:.|:..|||.|||    ...:|  .||
Zfish    70 SQFNVSSVTTFLIHGYRPTGSPPVWMKQF-VEFLLNRRDMNVIVVDWNRGA----TNMNYWQVVK 129

  Fly   220 PVGQVLAKFVDFLH--QEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRY 282
            ...:|.....|.:.  ::.|.....:.::|.|:|||::|..|.:. .|.:..|.|||||.|.|..
Zfish   130 NTRKVANNLTDLIQKMKDNGANLSSIHMIGVSLGAHISGFTGANF-NGEIGRITALDPAGPEFNG 193

  Fly   283 AKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQPGC--------FWHECSHWRA 339
            ..|::||...||.:||.|||.:.:.|:...:||:|:|||.|:.||||        .:.:|.|.|:
Zfish   194 RPPEDRLDPSDALFVEALHTDMDALGYRNLLGHIDYYANGGADQPGCPKTILSGSEYFKCDHQRS 258

  Fly   340 FMLFAESLARDQATGFLSQGCP--AAEWQQLTRFH--RCPKDTGVMQTMGGDLANVSA----EFL 396
            ..|:..|         ::..||  |...:..|.|.  .| .|.|..::.|..:....:    :.|
Zfish   259 VFLYMSS---------VNGSCPIIAYPCESYTDFQDGTC-MDCGKFKSAGCPIFGYDSVRWRDTL 313

  Fly   397 AQ-RQGVYYFQTNDQPPY 413
            .| .|...|||||...|:
Zfish   314 VQLEQTRTYFQTNKASPF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 81/272 (30%)
lipiaNP_001003499.1 Pancreat_lipase_like 43..327 CDD:238363 81/272 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578563
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.