DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG6271

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster


Alignment Length:305 Identity:101/305 - (33%)
Similarity:155/305 - (50%) Gaps:40/305 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 MNKGDQEQNQQFTSEPVNLY---------------DAASLRRSRFSPFNPTRILIHGWLGNENAN 179
            |...::.:.:..|:.|||.|               ...|:.:|.|:|.:|||.:||||..:...:
  Fly    52 MEAQEKLEGRGLTTVPVNFYLFTPKNPSSSKHIYATTKSISKSNFNPAHPTRFVIHGWTQSYLNS 116

  Fly   180 MYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQ 244
            |.:::..|:  |..|:||:..|||.|....||.|:...|...|:.:||.::||....|:...|:.
  Fly   117 MNSDIRKAF--LSKGDYNVIVVDWARARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVY 179

  Fly   245 LVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGF 309
            ::|.|:||||||.|||:.. |::..|..||||||.|.|.||.:||.::||.|||.:.|:.|:.||
  Fly   180 VIGHSLGAHVAGYAGKNTD-GQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGF 243

  Fly   310 DRPVGHVDFYANWGSQQPGC---FWHECSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRF 371
            .:|:|...||.|.|..||||   ....|||.|:...:||:::.|   .|.:..|  .::::..  
  Fly   244 LKPIGKGAFYPNGGKTQPGCPLDVTGACSHGRSTTYYAEAVSED---NFGTMKC--GDYEEAV-- 301

  Fly   372 HRCPKDTGVMQT---MGGDLANVSAEFLAQRQGVYYFQTNDQPPY 413
               .|:.|...:   ||.|......|      |.:|...|.:.|:
  Fly   302 ---AKECGSTYSSVRMGADTNAYMVE------GDFYVPVNSKAPF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 98/291 (34%)
CG6271NP_651526.1 Lipase 57..337 CDD:278576 99/298 (33%)
Pancreat_lipase_like 68..333 CDD:238363 96/283 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438404
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405444at33208
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.