DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG6283

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster


Alignment Length:305 Identity:95/305 - (31%)
Similarity:147/305 - (48%) Gaps:30/305 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 QVVGNTLTAAFGLNVMNKGDQEQNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENAN 179
            |:.|...|.|....|..|.:....::..::      :.|:..|.|:..:.||.:||||....:.:
  Fly    55 QMEGRISTNAVNFYVYTKSNPTDGKEIKAK------SGSVEDSHFNKDHGTRFVIHGWTQRYSDD 113

  Fly   180 MYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQ 244
            |...:..|:  |..|:||:..|||.|....||.::...|...|..:.:.:.:||...|:.::.|:
  Fly   114 MNTRITKAW--LSKGDYNVIVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLE 176

  Fly   245 LVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGF 309
            ::|.|:||||||.|||.:...|:..|..||||||.|.|.||.:||:.:||.|||.:.|:.|..||
  Fly   177 VIGHSLGAHVAGYAGKTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGF 241

  Fly   310 DRPVGHVDFYANWGSQQPGC---FWHECSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRF 371
            .:|:|...||.|.|..||||   ....|||.|:.:.:||::..|   .|.|..|...|       
  Fly   242 LKPIGKGAFYPNGGKSQPGCGLDATGSCSHARSVLYYAEAVTED---NFGSIKCHDYE------- 296

  Fly   372 HRCPKDTGVMQTMGGDLANVSAEFLAQR---QGVYYFQTNDQPPY 413
                  ..|.:..|...::|....:...   :|.:|...|.:.|:
  Fly   297 ------DAVAKNCGSTYSSVRMGAITNAYMVEGDFYVPVNSEAPF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 87/276 (32%)
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 89/289 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438403
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405444at33208
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.