DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and LIPC

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:373 Identity:102/373 - (27%)
Similarity:157/373 - (42%) Gaps:56/373 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LLYSAEHHTYFHLHTLVPQDNANRQTGPLKSEKESPHRRLFQQVVGNTLTAAFGLNVMNKGDQEQ 137
            ||...::|... |.|.|...:.:.:..|:   .|.|..|..|.|..|..........:..|:..|
Human    12 LLLKPQYHPQI-LITGVTTSSEDMRKAPV---SEEPFGRRAQAVETNKTLHEMKTRFLLFGETNQ 72

  Fly   138 NQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGW-LGNENANMYNELLPAYFDLRNGNYNIFTV 201
            ..|     :.:....:|:...|:...|..::|||| :.....|...:::.|.........|:..|
Human    73 GCQ-----IRINHPDTLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLV 132

  Fly   202 DWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHL-QTG 265
            ||...|...|..|....:.||:.:|..:.:|.:...:....:.|:|:|:||||:|.||..: .|.
Human   133 DWITLAHDHYTIAVRNTRLVGKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSSIGGTH 197

  Fly   266 RLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHT----SVG-SYGFDRPVGHVDFYANWGSQ 325
            ::..|..||.|.|.|..:.|..||:.:||::|:.:||    .:| |.|..:|:||.|||.|.||.
Human   198 KIGRITGLDAAGPLFEGSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSF 262

  Fly   326 QPGCFWHE------------------CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTR-- 370
            ||||.:.|                  |||.|:..||.:||..   .|..|...|..:....::  
Human   263 QPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLH---AGTQSMAYPCGDMNSFSQGL 324

  Fly   371 FHRCPKDTGVMQTMGGDLANVSAE--------FLAQRQ----GVYYFQ 406
            ...|.|  |...|:|   .:|..|        ||..|.    .||::|
Human   325 CLSCKK--GRCNTLG---YHVRQEPRSKSKRLFLVTRAQSPFKVYHYQ 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 87/308 (28%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145282
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.