DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG10116

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:311 Identity:94/311 - (30%)
Similarity:140/311 - (45%) Gaps:62/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 TLTAAFG-----LNVMNKGDQEQNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENAN 179
            |:.|.:|     ||.       :..|..::|:.. :..:|.||.|...:||.:.|..|||    |
  Fly    14 TIAAVYGETGFFLNT-------RRVQENAQPIEA-EVEALVRSSFYAADPTVVTIPRWLG----N 66

  Fly   180 MYNELLPAYFD--LRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFED 242
            :.:..:||...  |:..:.||.:||.........|..|         :|..|..||.:..|..:.
  Fly    67 ISSPEIPAVVSARLQQQDSNIISVDLSEANDETEIIDS---------VASLVIVLHNQFDMPLDR 122

  Fly   243 LQLVGFSMGAHVA-GLAGKHLQ-TGR-LRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSV 304
            :.:|||:.|||:| |:|.|..| .|| |..|.||||:    ..|:...:|:..||::|||:||:.
  Fly   123 ILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNA 183

  Fly   305 GSYGFDRPVGHVDFYANWGSQQPGCFWHECSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLT 369
            |..|....:||||:|.|.|..||||....|||.|||.|.||..:.:  ..|:|..|         
  Fly   184 GGEGTWERLGHVDYYPNGGQTQPGCTTDSCSHERAFELLAEMWSPE--NDFVSARC--------- 237

  Fly   370 RFHRCPKDTGVMQTMGGDLANVSAEFLAQRQ-------GVYYFQTNDQPPY 413
                     |.::|:.......|...:.|:|       |:|:.:|....|:
  Fly   238 ---------GSVETLSASSCRWSTHKMGQKQEEEQPASGIYFLETRQSSPF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 88/282 (31%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 89/294 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445965
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.