DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and lipca

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:318 Identity:94/318 - (29%)
Similarity:136/318 - (42%) Gaps:62/318 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 QFTSE--PVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTVD 202
            ::|.:  .:.|:...:|....|:...|..|:||||..:.....:...|.:......||.|:...|
Zfish    53 EYTEDTCALELFQPHTLDACGFNSSLPLAIIIHGWSVDGMMEKWISRLASALKSSEGNINVLIAD 117

  Fly   203 WGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHL-QTGR 266
            |...|...|..|:...:.|||.:|..:.:|..........:.|:|:|:|||::|.||.:| .:||
Zfish   118 WLTLAHQHYPIAAQNTRIVGQDIAHLLSWLEDFKQFPLGKVHLIGYSLGAHISGFAGSNLAMSGR 182

  Fly   267 -LRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHT----SVG-SYGFDRPVGHVDFYANWGSQ 325
             |..|..||||.|.|......:||:.|||.:|:.:||    .:| |.|..:||.|.|||.|.||.
Zfish   183 TLGRITGLDPAGPMFEGMSHTDRLSPEDAKFVDAIHTFTLQRMGLSVGIKQPVAHFDFYPNGGSF 247

  Fly   326 QPGCFWH--------------------ECSHWRAFMLFAESLA-RDQA---------TGFLSQGC 360
            ||||..|                    :|:|.||..||.:||. :|:.         |.|....|
Zfish   248 QPGCQLHMQNIYAHLAQHGIMGFEQTVKCAHERAVHLFIDSLLNKDKQIMAYKCSDNTAFDKGNC 312

  Fly   361 PAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGV---YYFQTNDQPPYVL 415
            ...      |.:||       .|:|.|:..|       |.|.   .:.:|....||.|
Zfish   313 LDC------RKNRC-------NTLGYDIKKV-------RTGKSKRLFLKTRSHMPYKL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 91/310 (29%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 94/318 (30%)
Pancreat_lipase_like 54..344 CDD:238363 91/309 (29%)
PLAT_LPL 351..485 CDD:238856 94/318 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578580
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.