DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and lipg

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:279 Identity:87/279 - (31%)
Similarity:130/279 - (46%) Gaps:40/279 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 FNPTR---ILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQ 223
            ||.|.   ::||||..:.....:...|.|....|....|:..|||...|...|..|....:.|||
Zfish    83 FNATLRTILIIHGWTMSGMFESWMHKLVAAVQRRESEANVVVVDWLGLANQLYPDAVNHTRRVGQ 147

  Fly   224 VLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKER 288
            .:|..:|:|.:|..::.|::.::|:|:||||||.||..: .|.:..|..||||.|.|..|....:
Zfish   148 SIATLLDWLQEEEQLQLENVHIIGYSLGAHVAGYAGTFV-NGIIGRITGLDPAGPMFEGADSYNK 211

  Fly   289 LTAEDADYVEVLHT----SVG-SYGFDRPVGHVDFYANWGSQQPGCFWHE--------------C 334
            |:.:|||:|:||||    ::| |.|...|:||:|.|.|.|..||||.:.|              |
Zfish   212 LSPDDADFVDVLHTYTRGALGVSIGIQEPIGHIDIYPNGGDVQPGCTFGEFLSAASGNFMEAMKC 276

  Fly   335 SHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHR-----CPKDTGVMQTMGGDLANVSAE 394
            .|.||..||.:||.......:..| |...:     ||.:     |.|:.  ..::|.:    :.:
Zfish   277 EHERAVHLFVDSLMNKDHVSYAFQ-CTGPD-----RFKKGICLSCRKNR--CNSIGYN----AKK 329

  Fly   395 FLAQRQGVYYFQTNDQPPY 413
            ...:|....|.:|....|:
Zfish   330 MRKRRNSKMYLKTRADTPF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 86/273 (32%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 87/279 (31%)
Pancreat_lipase_like 65..344 CDD:238363 86/273 (32%)
PLAT_LPL 351..486 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.