DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG10357

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster


Alignment Length:295 Identity:94/295 - (31%)
Similarity:139/295 - (47%) Gaps:56/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 RFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRN-----GNYNIFTVDWGRGAIADYITASYR 217
            :.|.....::::||:||   :..:..::|    |||     |..|:...|||..|..||.::...
  Fly    48 QLSSVESVKLIVHGYLG---SCTHGSIMP----LRNAYTAQGYENVLVADWGPVANLDYPSSRLA 105

  Fly   218 VKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRY 282
            ||.|.|:|||.::...|..|:..|.:.::|.|:|||:||..|::. .|.|..:..||||||.|. 
  Fly   106 VKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYF-NGSLGRVTGLDPALPLFS- 168

  Fly   283 AKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWG-SQQPGC----------FWHE--- 333
            ::..:.|.:..|.:|:|:||....:|..||.|.||||.|:| :.||||          ..||   
  Fly   169 SRSDDSLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYS 233

  Fly   334 CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLT-----RFHRCPKDTGVMQTMG-------- 385
            |||.||.|.:|||:...:  .|.:..|      .||     |...|.::.....|..        
  Fly   234 CSHNRAVMFYAESIGMPE--NFPAVSC------SLTAIKSRRVEDCLREKSKTNTENANDYQTVF 290

  Fly   386 -GDLANVSAEFLAQRQGVYYFQTNDQPPYVLAQNA 419
             |:..|.||..      .||.:||..|||...:|:
  Fly   291 MGEHVNRSATL------YYYLETNGAPPYGQGRNS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 89/283 (31%)
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 88/282 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.