DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG6472

DIOPT Version :10

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:234 Identity:43/234 - (18%)
Similarity:76/234 - (32%) Gaps:80/234 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ESATLA---ASGAADFTGKIWNAV---TGEEVHSLQHNHIVKTVAFSHDSQYLVTGSNEKLVRVF 125
            |.|.||   .:|..::....|:|:   .|::..:|    .|..:.|..::.|.:.|.   |..|.
  Fly     5 EPAPLALGYGNGTREWFVDRWDALLDTIGDDQETL----YVWVLTFYTNAIYWILGG---LFVVM 62

  Fly   126 DLNSEGKALESYAGHAG------------AVKRALFCRNEKCVISCADDKSMRLWDRGTGQEVSR 178
            ||....|.:..|....|            .||..||  |:..|                |...:.
  Fly    63 DLTEWPKFMRKYKNQPGMNEPLDWEKFKKLVKTLLF--NQTVV----------------GIPTAY 109

  Fly   179 VEFSSHPNGL----------ELSKDGSILTVTYGNCTAFYDMETL----------TQLKEITIPT 223
            :.|:...||:          .:.:|.:: .:|....|.:|....|          .:..|.|.|.
  Fly   110 IAFNLSRNGVPPPRALPSAFTVVRDFAV-CITLWEITFYYSHRLLHSRFFYKYVHKKHHEWTSPV 173

  Fly   224 RVSSASLHPDKHIFVCGGEDFKMYKYDYITGNEIESFKG 262
            .:::...||                ::|:..:.:..|.|
  Fly   174 ALAAMYAHP----------------FEYVISDLLPVFAG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 24/157 (15%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 33/192 (17%)

Return to query results.
Submit another query.