DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG6472

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:293 Identity:106/293 - (36%)
Similarity:148/293 - (50%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 TSEPVNLYDAASLRRSRFSPFN-PTRILIHGWLGNENA----NMYNELLPAYFDLRNGNYNIFTV 201
            :::.::|.|.|.|.:|.|: || |..|.:||:  :|:|    ....||..|:  ||.||||:..:
  Fly    56 SAQLLHLSDDARLAQSNFN-FNYPLAIYLHGF--SESATGERQSSQELKDAF--LRRGNYNVILI 115

  Fly   202 DW-GRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTG 265
            || ...|:..|..|...:...|:.||:|:.|| .:.|...:.:.|:|||:||.|||.|||.||..
  Fly   116 DWSAMTAVPWYSNAVENLPVSGRYLARFLRFL-VDKGYPAKYIHLIGFSLGAEVAGFAGKQLQEW 179

  Fly   266 RLRM--IRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQ-QP 327
            .:::  |.|||||||.|.......||:..||.:|:|:||..|..|...|:||.|||.|.|.. ||
  Fly   180 GIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPNGGRPLQP 244

  Fly   328 GCFWHE-----------CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRCPKDT-GV 380
            ||....           |||.||:..|.||:|  |..||.:|.|.             |.|. |:
  Fly   245 GCAKQNIANNWLGIIVGCSHQRAWEYFVESIA--QPRGFPAQRCE-------------PSDMFGI 294

  Fly   381 MQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPY 413
            .:..||..|.:......:.:|.:|..|||..|:
  Fly   295 CREPGGGPAFMGMGADPRIRGKFYLDTNDAKPF 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 103/287 (36%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 103/287 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.