DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG13282

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:281 Identity:87/281 - (30%)
Similarity:132/281 - (46%) Gaps:38/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 DAASLRRSRFSPFNPTRILIHGWLGNENANMY----NELLPAYFDLRNGNYNIFTVDWGRGAIAD 210
            :.::|..|.|:|..||:|:|||:    |::|:    .::...|  |...:|||..|||   :|..
  Fly   100 EKSNLTDSYFNPRYPTKIIIHGY----NSDMFLHPLQQMREEY--LAKADYNIIYVDW---SILS 155

  Fly   211 ----YITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIR 271
                ||:|.:..|..|...|:.|:.|.:...   .|:.::|||:||.|.....::|.:..|..|.
  Fly   156 PGPCYISAVHNTKHAGTCTAQLVERLVETGN---TDIHVIGFSLGAQVPNYIARNLSSFMLPRIT 217

  Fly   272 ALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQPGCFWHE--- 333
            .||||:|.|..:...::|...||.||:|:||:....|.....||.|||.|.|..||||...:   
  Fly   218 GLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERCGHADFYMNGGIMQPGCNGQKINS 282

  Fly   334 --CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFL 396
              |||.||...|.||:...:  ||....|.......|   ..|| .|..:...|.::...:    
  Fly   283 FACSHQRAPAYFLESIRSPK--GFWGWACSGYISYLL---GMCP-PTNFLLEAGENIRPTT---- 337

  Fly   397 AQRQGVYYFQTNDQPPYVLAQ 417
               :|::...|||..|:.|.:
  Fly   338 ---RGMFMIDTNDSSPFALGK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 83/271 (31%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 85/275 (31%)
Pancreat_lipase_like 75..347 CDD:238363 83/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445955
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.